PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0458s0080.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 504aa    MW: 54707.3 Da    PI: 6.6671
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0458s0080.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-39144204262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++k+l+cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  SapurV1A.0458s0080.1.p 144 PDKILPCPRCKSMDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 204
                             7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-29125201IPR003851Zinc finger, Dof-type
PfamPF027017.2E-32146202IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.705148202IPR003851Zinc finger, Dof-type
PROSITE patternPS013610150186IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MPEIKLFGKT IPLQVDQQQE DVCCADSKYE SSSGTPVAPH QSEEHGYTTT TAAASLHGKD  60
SPRTEREEQE GSHRESSGEE IANEKQEDVT SYQITEDSKD PTSSGISENP NTPSVERETS  120
HLKSSKDEEQ SETSISQEKT PMKPDKILPC PRCKSMDTKF CYFNNYNVNQ PRHFCKNCQR  180
YWTAGGTMRN VPVGAGRRKN KSSSASHYRH LMVPEALRTV QVHAMNGVHK PFMGNSSTVL  240
TFGPGSPLCE SIASVLNLSE KEQNSVRNEY HGPEHRIFVS CGGAGGDGDD SSSGSSATAS  300
NSSEKGCNGD SREAVNKDYQ SFPPQVPSFP GPPWSYPWNS AMPPPKPCPS GFPVSFYPAP  360
AYWGCTVPSP WNVPPYASLP SPPLNHCTQS SSPTSPLGKH SRDSNILNPA YLEAPSREGT  420
KSEKGVLVPK NLKIDDLGEA ARSSMWASLG IMSEKSNSIN GGGLFKGFQS KNEDRNYMAG  480
TTSVLQANPA ASSRSRNFHE NTL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2863040.0GU286304.1 Populus balsamifera isolate FBK13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863050.0GU286305.1 Populus balsamifera isolate FBK13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863060.0GU286306.1 Populus balsamifera isolate FRE01 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863070.0GU286307.1 Populus balsamifera isolate FRE01 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863080.0GU286308.1 Populus balsamifera isolate GIL14 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863090.0GU286309.1 Populus balsamifera isolate GIL14 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863100.0GU286310.1 Populus balsamifera isolate HAY07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863110.0GU286311.1 Populus balsamifera isolate HAY07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863120.0GU286312.1 Populus balsamifera isolate INU03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863130.0GU286313.1 Populus balsamifera isolate INU03 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863140.0GU286314.1 Populus balsamifera isolate KUU07 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863150.0GU286315.1 Populus balsamifera isolate KUU07 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863160.0GU286316.1 Populus balsamifera isolate MGR10 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863170.0GU286317.1 Populus balsamifera isolate MGR10 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863180.0GU286318.1 Populus balsamifera isolate POR11 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863190.0GU286319.1 Populus balsamifera isolate POR11 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863200.0GU286320.1 Populus balsamifera isolate RNA13 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863210.0GU286321.1 Populus balsamifera isolate RNA13 haplotype B Dof zinc finger protein gene, partial sequence.
GenBankGU2863220.0GU286322.1 Populus balsamifera isolate WHR03 haplotype A Dof zinc finger protein gene, partial sequence.
GenBankGU2863230.0GU286323.1 Populus balsamifera isolate WHR03 haplotype B Dof zinc finger protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011013327.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLU5G2270.0U5G227_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.16e-75cycling DOF factor 3